Predicting Intrinsically Disordered Regions of Protein Chains
A support document for FirstGlance in Jmol.

Purpose I: Crystallized residues are missing. Quite often some part of the protein sequence that was crystallized is missing in the 3D model.
Empty basket at missing residues.
This will be reported as Missing Residues under the Regions with missing residues will be marked with "empty baskets". You may like to know whether the missing part is predicited to be intrinsically disordered. If yes, then it is less likely to be resolved when the same protein sequence is crystallized under other conditions. Intrinsic disorder explains why parts of a chain are missing in a crystallographic result.

Purpose II: Residues were deleted before crystallization. Crystallization success is often improved by deleting flexible portions of a protein chain, especially intrinsicially disordered portions. You may like to know whether portions of a chain that were deleted for a crystallization experiment are predicted to be intrinsically disordered.

For an introduction to intrinsic disorder in proteins, see the article in Proteopedia Intrinsically Disordered Protein. There you will also find a list of five or more prediction servers. Below are instructions for using one of these servers, FoldIndex. If the results are important to you, try other servers to see how well they agree.

Before you begin the procedure below, take a careful look at the Missing Residues report by FirstGlance in Jmol under the
  1. Copy the sequence of the chain of interest. In FirstGlance, under the leftmost tab (usually labeled with the PDB code), click on Sequences. (These links will take you directly to sequences. In contrast, the links in the Resources Tab will take you to a general page on the PDB entry, where you will have to find the sequences.)

    • Note that the sequences available from OCA, PDB-Europe, and PDB-USA (RCSB) span only the sequence range used for structure determination, which are quite often not full length sequences for the molecule in question. These crystallized sequences are suitable for Purpose I above. The FASTA sequences available from OCA are most convenient for copying.

    • Full length sequences are available from UniProt. These are suitable for Purpose II above.

  2. Go to the FoldIndex Server.

  3. Paste the sequence into the box. (FoldIndex will ignore the FASTA description line, beginning ">".)

  4. Click the Process button. Now you have your results.

    • Caution! Don't look for predicted disorder by sequence number! Why? FoldIndex numbers the sequence starting at one. However, the first residue in a chain is often not numbered one in PDB files. Worse, the sequence numbering in PDB files is sometimes not consecutive because of numbering according to an ancestral sequence, leading to insertions and deletions with bizzare numbering. Keep reading ...

  5. Purpose I: Crystallized residues are missing.

  6. To find a segment that FoldIndex predicts to be disordered, use the sequence capability of the Find.. tool (under the Tools Tab).

    1. Quick check: Copy the segment predicted to be disordered and see if it is found. If it is, then none of it is missing in the model! As an example, we'll use 2ace. FoldIndex marks predicted disorder in red. Here we have copied the first red segment:

      Be sure to remove the spaces when you paste the sequence into the slot in the Find.. tool:

      • Incorrect query: sequence=KPWSGVWNA STYPNNCQQY VDEQFPGFSG SEMWNPNRE

      • Correct query: sequence=KPWSGVWNASTYPNNCQQYVDEQFPGFSGSEMWNPNRE

      If the red sequence is found, then none of the residues in that sequence are missing in the 3D model, and it was not disordered in the crystal.

    2. If the red sequence is not found, some or all of the red sequence is missing from the 3D model. If even one residue in the sequence is missing, the sequence will not be found.

      To locate the missing residues in the 3D model, copy a short sequence of 4-5 residues that precedes or follows the putatively disordered segment. Use this sequence in the Find.. tool.

      Be sure to remove the spaces when you paste the sequence into the slot in the Find.. tool:

      • Incorrect query: sequence=RIM HY

      • Correct query: sequence=RIMHY

      Once you locate the general area with a preceding or following sequence fragment, you will see an "empty basket" (marking missing residues) nearby. Touch or click on the end(s) of the chain near that basket to report the residues at the "broken end(s)".

    Purpose II: Residues were deleted before crystallization.

  7. To find out whether residues were deleted from the full length sequence before crystallization, check the lengths of the sequences.

    1. The length of the crystallized sequence is given in the FASTA title line at the OCA server. Click on Sequences under the and then click on the desired chain under OCA. Note the sequence length.
        >2ace_A mol:protein length:537  ACETYLCHOLINESTERASE
        DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
        ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGG
        ...
        
    2. The full length is given in UniProt. Go to the Resources Tab and click on the chain of interest under UniProt. At UniProt, click on Sequences in the gray bar. Here you will find the full length (red arrow):

      In our example, 2ace, a protein chain of length 537 was crystallized, but the full length sequence is 586 amino acids. Note that in some cases, an expression tag may have been added to the crystallized sequence.

    3. What portions were deleted (or added?) before crystallization? This can best be answered by aligning the crystallized sequence with the full-length sequence. At UniProt, click on the Align tab at the top of the page. Use the Clear button to clear the form box. Paste the two FASTA sequences into the box. (You can enlarge the box by dragging the lower right corner to help see what you are doing.) The box should look similar to this. (A blank line between the FASTA sequences is OK but not necessary).



    4. After clicking the Align button, the resulting alignment shows (in the example of 2ace) that the first 21 residues and the last 28 residues were deleted in the crystallized chain.



      FoldIndex does not make predictions for the first and last 25 residues due the size of its scanning interval (51 residues by default). In a different case having larger deletions, the predictions of FoldIndex for the full-length sequence would be more useful.
Suggestions for improvement? Please contact