---------------------------------------------------------------------------- GETPROPERTY ---------------------------------------------------------------------------- In the Jmol Console, getProperty("chainInfo") reports directly to the console. See exploreChainInfo() and firstAndLastResNos in moltab.js The latter gives last resno for chain A in 1d66 as 68, which is Cd! chainInfo.models.length always seems to be 1 even w/ NMR ??? In Jmol 11, one can use getproperty() to put header fields into a javascript variable. See item #82 at http://chemapps.stolaf.edu/jmol/docs/examples-11/new8.htm There are Jmol command: getProperty() Javascript functions defined in Jmol.js: jmolGetPropertyAsString() jmolGetPropertyAsArray() Example: jmolGetPropertyAsString("fileinfo", "expdta") returns experimental method. This is at the bottom of the above document: jmolGetPropertyAsString("fileHeader") and you can get lots of other things the same way: N.B. fileName (URL) moleculeInfo includes atom count for each element, per "molecule" (chain). for 1d66, moleculeInfo[4].mf="C 288 N 91 O 82 S 6 Cd 2" auxiliaryInfo includes auxiliaryInfo.models[0].hetNames.CD="CADMIUM" auxiliaryInfo.models[0].title="1D66" modelInfo.models[0].atomCount=1762 modelInfo.models[0].bondCount=1830 modelInfo.models[0].polymerCount=4 <<<<< modelInfo.models[0].file="http://chemapps.stolaf.edu/jmol/docs/examples-11/data/1d66.pdb" modelInfo.models[0].moleculeCount=57 modelInfo.models[0].chainCount=5 modelInfo.models[0].num=1 modelInfo.models[0].vibrationVectors="false" modelInfo.models[0].title="1D66" modelInfo.models[0].groupCount=207 <<<<< How do you get a list of the chain names? They are mentioned in polymerInfo but once for each residue! Ditto for chainInfo. HELIX, SHEET and TURN elements are numbered, e.g. H1, H1, T1, S1, etc. You can display each with display structureid="s1" (which hides the rest) How about an option to make the rest translucent? For cartoon, you have to make coil translucent 7 and (helix,sheet) translucent 6; or use a white background where 6 works for all. However, opaque white coil on a white background is not distinct; would need to make it fatter. polymerInfo.models[0].polymers[2].sequence="EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESRLERL" [appletInfo] [animationInfo] [fileName] [fileHeader] [fileContents] [atomList] [atomInfo] [bondInfo] [moleculeInfo] [extractModel] [orientationInfo] [auxiliaryInfo] [transformInfo] [centerInfo] [boundboxInfo] [modelInfo] [polymerInfo] [chainInfo] [shapeInfo] [stateInfo] [reload THIS orientation] ---------------------------------------------------------------------------- ---------------------------------------------------------------------------- ---------------------------------------------------------------------------- CONSURF HEADER SECURITY EXCEPTION ---------------------------------------------------------------------------- April 2010: In the present Firstglance, I am using messagecallback for "show pdbheader", from which I get ConSurf output in a non-standard PDB file header generated at the ConSurf server. In Firefox 3.6 (OS X), with Jmol 11.8.22, the "show pdbheader" request generates a java.security.AccessControlException, access denied (java.io.FilePermission .../1d66.pdb file read). The signed applet bypasses this problem, which also notably does not occur in Safari. After using the signed applet, in the same browser session, the unsigned applet can access the PDB header! In a new session, the read permission is again denied. See email to jmol-users 4/12/10 "12.0.RC4 vs. Firstglance". ---------------------------------------------------------------------------- ---------------------------------------------------------------------------- ---------------------------------------------------------------------------- ---------------------------------------------------------------------------- ----------------------------------------------------------------------------