:: PredictBias ::

A) Input parameters
Genome	clo.gb	Threshold dinucleotide bias	2
Threshold codon bias	4	Threshold %GC bias	3
E-value (RPSBlast)	0.05	Genome (non-pathogenic)

B) Compare a potential GI or PAI in related non-pathogenic sp. (phylogenetic tree)
Potential GI or PAI start end
Select Organism

C) Potential GIs and PAIs in NZ_CP076401 (download)

S.No

Start

End

Bias

Virulence

Insertion elements

Prediction

KNZ77_RS01315

KNZ77_RS01345

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS01315	5	13	-2.639073	4-hydroxyphenylacetate decarboxylase small
KNZ77_RS01320	4	10	-4.439609	4-hydroxyphenylacetate decarboxylase activase
KNZ77_RS01325	4	11	-5.494911	CPBP family intramembrane metalloprotease
KNZ77_RS01330	2	12	-5.797767	CPBP family intramembrane metalloprotease
KNZ77_RS01335	-1	13	-4.891338	glyoxalase
KNZ77_RS01340	0	13	-4.523076	ABC transporter ATP-binding protein
KNZ77_RS01345	-1	9	-3.769540	FtsX-like permease family protein

KNZ77_RS01735

KNZ77_RS01825

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS01735	4	9	-0.811870	carbon storage regulator CsrA
KNZ77_RS01740	2	7	-3.224381	flagellar export chaperone FliS
KNZ77_RS01745	0	7	-3.634357	flagellar export chaperone FliS
KNZ77_RS01750	-1	7	-3.398578	flagellar filament capping protein FliD
KNZ77_RS01755	-2	8	-4.274705	flagellar protein FliT
KNZ77_RS01760	-1	8	-3.923549	flagellin
KNZ77_RS01765	-1	9	-4.501912	glycosyltransferase
KNZ77_RS01770	0	9	-3.595003	bifunctional glycosyltransferase family 2
KNZ77_RS01775	-1	9	-3.237792	glycosyltransferase
KNZ77_RS01780	-1	11	-3.427393	peptidoglycan bridge formation glycyltransferase
KNZ77_RS01785	1	14	-2.482691	ATP-grasp domain-containing protein
KNZ77_RS01790	2	14	-2.293151	ornithine cyclodeaminase/mu-crystallin family
KNZ77_RS01795	-1	13	0.188539	FdtA/QdtA family cupin domain-containing
KNZ77_RS01800	0	13	0.530347	DegT/DnrJ/EryC1/StrS family aminotransferase
KNZ77_RS01805	2	13	0.654724	flagellar basal body rod protein FlgB
KNZ77_RS01810	2	12	1.430480	flagellar basal body rod protein FlgC
KNZ77_RS01815	3	11	0.746951	flagellar hook-basal body complex protein FliE
KNZ77_RS01820	3	9	-0.244725	flagellar M-ring protein FliF
KNZ77_RS01825	2	6	-0.798247	flagellar motor switch protein FliG

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS01760	FLAGELLIN	40	3e-08	Flagellin signature.
>FLAGELLIN#Flagellin signature. Length = 507 Score = 40.4 bits (94), Expect = 3e-08 Identities = 18/44 (40%), Positives = 30/44 (68%) Query: 1 MRVNTNVSALIANNQMGRNVNAQSKSMEKLSSGVRIKRAADDAA 44 +NTN +L+ N + ++ ++ S ++E+LSSG+RI A DDAA Sbjct: 2 QVINTNSLSLLTQNNLNKSQSSLSSAIERLSSGLRINSAKDDAA 45
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS01805	FLGHOOKAP1	26	0.002	Flagellar hook-associated protein signature.
>FLGHOOKAP1#Flagellar hook-associated protein signature. Length = 546 Score = 26.5 bits (58), Expect = 0.002 Identities = 11/30 (36%), Positives = 15/30 (50%) Query: 10 GLDATNLRSQTIANNIANINTEGYKRHYIT 39 GL+A T +NNI++ N GY R Sbjct: 10 GLNAAQAALNTASNNISSYNVAGYTRQTTI 39

KNZ77_RS02020

KNZ77_RS02055

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS02020	2	11	1.200011	PTS sugar transporter subunit IIB
KNZ77_RS02025	2	11	1.053654	PTS sugar transporter subunit IIC
KNZ77_RS02030	2	9	1.147103	PTS system mannose/fructose/sorbose family
KNZ77_RS02035	2	12	0.323726	L-2-amino-thiazoline-4-carboxylic acid
KNZ77_RS02040	3	12	0.815643	M20 family metallopeptidase
KNZ77_RS02050	2	15	0.970026	helix-turn-helix domain-containing protein
KNZ77_RS02055	2	13	0.620486	PLD nuclease N-terminal domain-containing

KNZ77_RS02105

KNZ77_RS02190

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS02105	3	12	0.195359	ribose ABC transporter permease
KNZ77_RS02110	2	11	-0.800055	M20 family metallopeptidase
KNZ77_RS02115	1	11	-1.503214	glutamine amidotransferase
KNZ77_RS02120	0	10	-2.660334	M20 family metallopeptidase
KNZ77_RS02125	3	13	-3.283841	DUF5685 family protein
KNZ77_RS02130	3	13	-2.324873	hypothetical protein
KNZ77_RS02135	1	12	-1.255282	hypothetical protein
KNZ77_RS02140	0	11	-1.068494	HAD-IB family hydrolase
KNZ77_RS02145	0	10	-0.295814	hypothetical protein
KNZ77_RS02150	1	12	0.745027	hypothetical protein
KNZ77_RS02155	-1	14	1.760266	metalloregulator ArsR/SmtB family transcription
KNZ77_RS02160	0	18	2.220785	heavy metal translocating P-type ATPase
KNZ77_RS02180	6	31	3.200463	DedA family protein
KNZ77_RS02185	6	34	4.279062	ABC transporter permease
KNZ77_RS02190	3	28	3.515760	ABC transporter permease

KNZ77_RS02315

KNZ77_RS02360

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS02315	1	13	-4.123202	hypothetical protein
KNZ77_RS02320	1	12	-3.766243	YkgJ family cysteine cluster protein
KNZ77_RS02325	0	12	-3.057173	MBL fold metallo-hydrolase
KNZ77_RS02330	0	11	-2.873912	GTP pyrophosphokinase family protein
KNZ77_RS02335	0	11	-3.032299	metallophosphoesterase
KNZ77_RS02340	-1	11	-3.354391	hypothetical protein
KNZ77_RS02345	-3	11	-2.743562	SAM-dependent methyltransferase
KNZ77_RS02350	-1	11	-1.315124	hydrolase
KNZ77_RS02355	0	14	-0.759312	hypothetical protein
KNZ77_RS02360	2	14	-0.670163	helix-turn-helix domain-containing protein

KNZ77_RS02475

KNZ77_RS02500

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS02475	4	16	-1.880641	ATP-dependent helicase
KNZ77_RS18610	3	15	-3.852111	hypothetical protein
KNZ77_RS02480	3	13	-4.025913	hypothetical protein
KNZ77_RS02485	3	13	-4.301218	hypothetical protein
KNZ77_RS02490	1	11	-3.447998	helix-turn-helix transcriptional regulator
KNZ77_RS02500	1	12	-3.758515	N-6 DNA methylase

KNZ77_RS02625

KNZ77_RS02705

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS02625	2	18	-2.142170	HAMP domain-containing histidine kinase
KNZ77_RS02630	5	18	-2.528216	response regulator transcription factor
KNZ77_RS02635	5	18	-2.150278	TetR/AcrR family transcriptional regulator
KNZ77_RS02640	4	21	-1.415057	MBL fold metallo-hydrolase
KNZ77_RS02645	4	18	-2.201555	MurR/RpiR family transcriptional regulator
KNZ77_RS02650	3	18	-1.829183	MurR/RpiR family transcriptional regulator
KNZ77_RS02655	3	16	-1.655018	Cof-type HAD-IIB family hydrolase
KNZ77_RS02660	3	17	-1.675472	alpha-glucosidase
KNZ77_RS02665	2	15	-2.003945	PTS transporter subunit IIBCA
KNZ77_RS02670	1	11	-3.078559	BlaR1 family beta-lactam sensor/signal
KNZ77_RS02675	0	15	-2.333399	BlaI/MecI/CopY family transcriptional regulator
KNZ77_RS02680	0	15	-3.063849	flavodoxin family protein
KNZ77_RS02685	2	14	-2.166209	MarR family transcriptional regulator
KNZ77_RS02690	1	14	-0.369199	EFR1 family ferrodoxin
KNZ77_RS02695	1	20	1.245470	uracil-DNA glycosylase family protein
KNZ77_RS02700	2	21	2.974463	hypothetical protein
KNZ77_RS02705	2	22	3.079581	hypothetical protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS02630	HTHFIS	30	2e-04	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 29.8 bits (67), Expect = 2e-04 Identities = 8/38 (21%), Positives = 17/38 (44%) Query: 2 AKILLLEDNDTITFGIKTSLEKKNHTVCCYNTIAEAKK 39 A IL+ +D+ I + +L + + V + A + Sbjct: 4 ATILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWR 41
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS02635	HTHTETR	32	2e-05	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 32.3 bits (73), Expect = 2e-05 Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 10 EKIQRENEIIDKAEKLFCLNGFDNTTMNELAKEV 43 E + I+D A +LF G +T++ E+AK Sbjct: 8 EAQETRQHILDVALRLFSQQGVSSTSLGEIAKAA 41

KNZ77_RS02795

KNZ77_RS02845

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS02795	-1	13	-3.361626	PTS system mannose/fructose/sorbose family
KNZ77_RS02800	-2	11	-4.819697	Fic family protein
KNZ77_RS02805	-2	13	-4.769696	hypothetical protein
KNZ77_RS02810	-2	14	-4.365061	LytTR family DNA-binding domain-containing
KNZ77_RS02815	1	12	-6.684256	sensor histidine kinase
KNZ77_RS02825	1	12	-6.509208	radical SAM protein
KNZ77_RS02830	0	12	-6.040466	radical SAM protein
KNZ77_RS02835	-1	10	-5.255816	hypothetical protein
KNZ77_RS02840	-1	9	-5.409260	FtsX-like permease family protein
KNZ77_RS02845	-1	7	-4.654884	radical SAM protein

KNZ77_RS03050

KNZ77_RS03085

Genomic Island

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS03050	2	13	0.436263	spore cortex-lytic germination protein SleC
KNZ77_RS03055	3	14	-0.719803	PrsW family intramembrane metalloprotease
KNZ77_RS03060	3	14	0.176544	RsmB/NOP family class I SAM-dependent RNA
KNZ77_RS03065	2	15	0.158344	signal peptidase I
KNZ77_RS03070	2	13	0.087574	signal peptidase I
KNZ77_RS03075	0	13	0.408991	TIM barrel protein
KNZ77_RS03080	0	14	0.706243	nucleoside kinase
KNZ77_RS03085	2	11	0.230584	glutaminase A

KNZ77_RS03135

KNZ77_RS03210

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS03135	2	11	-0.758648	BMP family ABC transporter substrate-binding
KNZ77_RS03140	3	10	-1.448430	BMP family ABC transporter substrate-binding
KNZ77_RS03145	2	11	-2.539189	hypothetical protein
KNZ77_RS03150	1	11	-1.973426	putative sporulation protein YtxC
KNZ77_RS03155	-1	10	-1.242480	DUF445 family protein
KNZ77_RS03160	-2	11	-1.317656	threonine--tRNA ligase
KNZ77_RS03165	-3	8	-1.141848	Rpn family recombination-promoting
KNZ77_RS03170	-1	11	0.195760	sensor histidine kinase
KNZ77_RS03175	3	22	4.863749	hydrolase
KNZ77_RS03180	2	21	3.840701	MFS transporter
KNZ77_RS03185	2	20	2.777080	TetR/AcrR family transcriptional regulator
KNZ77_RS03190	2	19	1.985649	NADP-dependent glyceraldehyde-3-phosphate
KNZ77_RS03195	3	22	1.723523	TetR/AcrR family transcriptional regulator
KNZ77_RS03200	3	20	1.328096	PEP-utilizing enzyme
KNZ77_RS03210	0	13	-4.525968	GGDEF domain-containing protein

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS03150	INTIMIN	24	0.018	Intimin signature.
>INTIMIN#Intimin signature. Length = 939 Score = 24.3 bits (52), Expect = 0.018 Identities = 13/35 (37%), Positives = 19/35 (54%) Query: 8 SSMKFLRNNNVNDRLIYTNDIVEVVIDSAKQEVLN 42 S K L +N+ +RL YT E V D +K + +N Sbjct: 49 SDSKLLTHNSYQNRLFYTLKTGETVADLSKSQDIN 83
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS03185	HTHTETR	29	3e-04	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 28.8 bits (64), Expect = 3e-04 Identities = 10/44 (22%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 1 MAKSFTEIEKDNIRKRLISECEINWSKYGYKKTNIDELCSKSGI 44 MA+ T+ E R+ ++ +S+ G T++ E+ +G+ Sbjct: 1 MARK-TKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGV 43
ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS03195	HTHTETR	37	6e-07	TetR bacterial regulatory protein HTH signature.
>HTHTETR#TetR bacterial regulatory protein HTH signature. Length = 215 Score = 36.5 bits (84), Expect = 6e-07 Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 8 TPEQQAERREKIVAVALSLMAENGFQKTSMREIAVLA 44 T ++ E R+ I+ VAL L ++ G TS+ EIA A Sbjct: 5 TKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAA 41

KNZ77_RS03260

KNZ77_RS03550

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS03260	4	14	0.142505	lipoprotein
KNZ77_RS03265	2	14	1.333403	DUF3788 domain-containing protein
KNZ77_RS03270	3	13	1.443048	DUF3440 domain-containing protein
KNZ77_RS03275	3	15	1.944579	ParB/RepB/Spo0J family partition protein
KNZ77_RS03280	1	19	1.610978	spore coat associated protein CotJA
KNZ77_RS03285	3	19	2.171852	spore coat protein CotJB
KNZ77_RS03290	3	23	2.348185	manganese catalase family protein
KNZ77_RS03295	2	24	3.728886	methylated-DNA--[protein]-cysteine
KNZ77_RS03300	2	24	3.405289	class I SAM-dependent methyltransferase
KNZ77_RS03305	2	27	4.527741	hypothetical protein
KNZ77_RS03310	4	26	4.613997	DUF3795 domain-containing protein
KNZ77_RS03315	4	27	4.253381	GrpB family protein
KNZ77_RS03320	2	26	3.106892	chloride channel protein
KNZ77_RS03325	2	25	0.604616	urea carboxylase-associated family protein
KNZ77_RS03330	2	18	-0.349747	GrpB family protein
KNZ77_RS03335	1	17	-1.087860	ATP-binding protein
KNZ77_RS03340	0	16	-1.465152	LytTR family DNA-binding domain-containing
KNZ77_RS18635	-1	18	-2.082978	ABC transporter permease
KNZ77_RS03350	1	17	-2.016767	ABC transporter ATP-binding protein
KNZ77_RS03355	0	15	-2.074639	hypothetical protein
KNZ77_RS03360	1	17	-2.451164	TetR/AcrR family transcriptional regulator
KNZ77_RS03370	0	17	-3.213619	MerR family transcriptional regulator
KNZ77_RS03380	1	16	-2.783085	CPBP family intramembrane metalloprotease
KNZ77_RS03385	-1	13	-3.021495	LytTR family transcriptional regulator
KNZ77_RS03390	-3	18	-1.018918	YvrJ family protein
KNZ77_RS03395	-2	17	-0.923386	DUF2922 domain-containing protein
KNZ77_RS03400	-2	18	-0.696629	DUF1659 domain-containing protein
KNZ77_RS03405	-2	20	-0.460423	transcriptional regulator
KNZ77_RS03410	-2	19	-0.052913	conserved phage C-terminal domain-containing
KNZ77_RS03415	1	19	1.574358	AAA family ATPase
KNZ77_RS03420	4	20	1.573877	transcriptional regulator
KNZ77_RS03425	4	18	2.831419	4Fe-4S binding protein
KNZ77_RS03430	2	17	2.820212	4Fe-4S binding protein
KNZ77_RS03435	3	18	2.775772	Crp/Fnr family transcriptional regulator
KNZ77_RS03440	1	16	2.766441	MATE family efflux transporter
KNZ77_RS03445	3	20	2.225469	PadR family transcriptional regulator
KNZ77_RS03450	4	18	1.945253	hypothetical protein
KNZ77_RS03455	2	18	0.769218	DNA alkylation repair protein
KNZ77_RS03460	2	16	-0.860506	nuclear transport factor 2 family protein
KNZ77_RS03465	2	15	-1.298675	alpha/beta hydrolase
KNZ77_RS03470	2	15	-2.555063	radical SAM protein
KNZ77_RS03475	2	13	-3.084044	GNAT family N-acetyltransferase
KNZ77_RS03480	0	14	-2.999752	hypothetical protein
KNZ77_RS03485	-1	14	-2.613417	Rpn family recombination-promoting
KNZ77_RS03490	0	15	-2.433287	DUF3841 domain-containing protein
KNZ77_RS03495	0	16	-1.658680	hypothetical protein
KNZ77_RS03500	2	17	-1.942499	helix-turn-helix transcriptional regulator
KNZ77_RS03505	2	17	-2.163632	hypothetical protein
KNZ77_RS03510	3	17	-2.283340	response regulator transcription factor
KNZ77_RS03515	4	16	-2.229356	sensor histidine kinase
KNZ77_RS03520	3	17	0.052961	ABC transporter ATP-binding protein
KNZ77_RS03525	4	19	1.108368	ABC transporter permease subunit
KNZ77_RS18640	3	21	2.322833	hypothetical protein
KNZ77_RS18645	3	20	2.367322	GntR family transcriptional regulator
KNZ77_RS03535	3	19	2.197640	S9 family peptidase
KNZ77_RS03540	3	19	1.912778	S9 family peptidase
KNZ77_RS03545	2	18	1.209912	hypothetical protein
KNZ77_RS03550	2	17	0.730916	GntR family transcriptional regulator

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS03510	HTHFIS	35	2e-06	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 35.2 bits (81), Expect = 2e-06 Identities = 10/38 (26%), Positives = 16/38 (42%) Query: 3 ILLVEDDKNIREMVYDFLISENYSVKTAIDGNTAIEIF 40 IL+ +DD IR ++ L Y V+ + T Sbjct: 6 ILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWI 43

KNZ77_RS03895

KNZ77_RS03960

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS03895	-1	7	3.083485	tetratricopeptide repeat protein
KNZ77_RS03900	0	13	3.964717	LysR family transcriptional regulator
KNZ77_RS03905	1	14	4.120069	sugar O-acetyltransferase
KNZ77_RS03910	2	15	4.096849	bifunctional enoyl-CoA hydratase/phosphate
KNZ77_RS03915	2	18	4.615650	anaerobic carbon-monoxide dehydrogenase
KNZ77_RS03920	1	18	4.402701	carbon monoxide dehydrogenase accessory protein
KNZ77_RS03925	2	19	4.630809	formate--tetrahydrofolate ligase
KNZ77_RS03930	1	16	4.296920	cyclodeaminase/cyclohydrolase family protein
KNZ77_RS03935	0	16	4.454416	bifunctional 5,10-methylene-tetrahydrofolate
KNZ77_RS03940	0	18	4.255392	methylenetetrahydrofolate reductase C-terminal
KNZ77_RS03945	-1	18	4.136282	methylenetetrahydrofolate reductase
KNZ77_RS03950	1	21	4.269753	dihydrolipoyl dehydrogenase
KNZ77_RS03955	0	23	4.009384	carbon monoxide dehydrogenase accessory protein
KNZ77_RS03960	0	20	3.097662	acetyl-CoA decarbonylase/synthase complex

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS03920	NUCEPIMERASE	26	0.005	Nucleotide sugar epimerase signature.
>NUCEPIMERASE#Nucleotide sugar epimerase signature. Length = 334 Score = 25.5 bits (56), Expect = 0.005 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 6/37 (16%) Query: 1 MKIAITGKGG-VGKTTFSSMLSRMFAEDGYRVVAVDA 36 MK +TG G +G +S+ E G++VV +D Sbjct: 1 MKYLVTGAAGFIG-----FHVSKRLLEAGHQVVGIDN 32

KNZ77_RS04310

KNZ77_RS04445

Pathogenicity Island (biased-composition)

LocusTag	DNBias	CDNBias	%GCBias	Product
KNZ77_RS04310	-1	13	3.483212	NAD(+) synthase
KNZ77_RS04315	-1	13	3.532691	YebC/PmpR family DNA-binding transcriptional
KNZ77_RS04320	1	14	3.797553	substrate-binding domain-containing protein
KNZ77_RS04325	0	14	4.180362	hydroxymethylglutaryl-CoA lyase
KNZ77_RS04330	1	13	4.592111	SLC13 family permease
KNZ77_RS04335	0	12	4.381567	CoA transferase
KNZ77_RS04340	0	13	4.475508	enoyl-CoA hydratase-related protein
KNZ77_RS04345	-1	11	3.865387	GntP family permease
KNZ77_RS04350	-1	10	3.057344	CoA transferase
KNZ77_RS04355	1	9	2.277351	acyl-CoA dehydrogenase family protein
KNZ77_RS04360	-1	10	1.576614	electron transfer flavoprotein subunit beta/FixA
KNZ77_RS04365	-1	10	0.263041	electron transfer flavoprotein subunit
KNZ77_RS04370	0	11	-0.568298	sigma-54-dependent Fis family transcriptional
KNZ77_RS04375	2	12	-1.302174	hypothetical protein
KNZ77_RS04380	2	12	-1.305934	DUF4116 domain-containing protein
KNZ77_RS04385	-2	11	-1.604116	flavodoxin domain-containing protein
KNZ77_RS04390	-1	10	-1.114733	GGDEF and EAL domain-containing protein
KNZ77_RS04395	-2	10	-0.260121	universal stress protein
KNZ77_RS04400	-1	8	-0.349629	PTS sugar transporter subunit IIBC
KNZ77_RS04405	0	10	0.619547	FCD domain-containing protein
KNZ77_RS04410	0	12	1.919730	MFS transporter
KNZ77_RS04415	0	16	3.198417	beta-glucoside-specific PTS transporter subunit
KNZ77_RS04420	2	25	3.870520	glycoside hydrolase family 1 protein
KNZ77_RS04425	4	33	4.514467	PRD domain-containing protein
KNZ77_RS04430	5	32	5.224331	response regulator transcription factor
KNZ77_RS04435	4	29	4.510270	HAMP domain-containing histidine kinase
KNZ77_RS04440	5	22	3.770706	ABC transporter ATP-binding protein
KNZ77_RS04445	2	14	2.802547	ABC transporter permease

ORFs having significant similarity with Known Virulence factors
LocusTag	Hits	Score	E-value	Comments
KNZ77_RS04430	HTHFIS	31	8e-05	FIS bacterial regulatory protein HTH signature.
>HTHFIS#FIS bacterial regulatory protein HTH signature. Length = 484 Score = 31.0 bits (70), Expect = 8e-05 Identities = 6/42 (14%), Positives = 17/42 (40%) Query: 3 KVLIIDDDKDLCILLKKSISIEQIEANYCHSGRDGLVELSKQ 44 +L+ DDD + +L +++S + + ++ Sbjct: 5 TILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWIAAG 46